Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405715 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPOCK3 antibody: synthetic peptide directed towards the middle region of human SPOCK3
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWF
KALHE SGSQNKKTKT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Smooth muscle-endothelial cell communication activates Reelin signaling and regulates lymphatic vessel formation.
The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Lutter S, Xie S, Tatin F, Makinen T
The Journal of cell biology 2012 Jun 11;197(6):837-49
The Journal of cell biology 2012 Jun 11;197(6):837-49
The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A
Genome research 2003 Oct;13(10):2265-70
Genome research 2003 Oct;13(10):2265-70
No comments: Submit comment
No validations: Submit validation data