HPA016519

antibody from Atlas Antibodies

Targeting: WNK2 KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43

Antibody data

Submit

Validation data

Product number: HPA016519 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA016519, RRID:AB_2669380
Product name: Anti-WNK2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GTSSSMTAESSPRSMLGYDRDGRQVASDSHVVPSV PQDVPAFVRPARVEPTDRDGGEAGESSAEPPPSDM GTVGGQASHPQTLGARALGSPRKRPEQQDVSSPAK TVGRFSVVSTQDEWTLASPHSLR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

WNK2 protein structure - HPA016519 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-WNK2 antibody. Corresponding WNK2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, colon, fallopian tube and liver using Anti-WNK2 antibody HPA016519 (A) shows similar protein distribution across tissues to independent antibody HPA015555 (B).
Antibody #2 product nr: HPA015555
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-WNK2 antibody HPA016519.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-WNK2 antibody HPA016519.
Sample type: HUMAN