Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027328-M05 - Provider product page
- Provider
- Abnova Corporation
- Product name
- PCDH11X monoclonal antibody (M05), clone 7B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PCDH11X.
- Antigen sequence
AQASALCYSPPLAQAAAISHSSPLPQVIALHRSQA
QSSVSLQQGWVQGADGLCSVDQGVQGSATSQFYTM
SERLHPSDDSIKVIPLTTFTPRQQARPSRGDSPIM
EEHP- Isotype
- IgG
- Antibody clone number
- 7B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PCDH11X monoclonal antibody (M05), clone 7B4. Western Blot analysis of PCDH11X expression in A-431.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PCDH11X is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol