HPA020873

antibody from Atlas Antibodies

Targeting: NEK1 KIAA1901, NY-REN-55

Antibody data

Submit

Validation data

Product number: HPA020873 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA020873, RRID:AB_10671583
Product name: Anti-NEK1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSV SSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVG EVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQ TELLENTTIRSEISPEGEKYKPLITGEKKVQCISH EINPSA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

NEK1 protein structure - HPA020873 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skin tissues using HPA020873 antibody. Corresponding NEK1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human endometrium, fallopian tube, skin and testis using Anti-NEK1 antibody HPA020873 (A) shows similar protein distribution across tissues to independent antibody HPA040413 (B).
Antibody #2 product nr: HPA040413
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells.
Sample type: HUMAN