H00051079-B02P
antibody from Abnova Corporation
Targeting: NDUFA13
B16.6, CDA016, CGI-39, GRIM-19, GRIM19
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051079-B02P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051079-B02P, RRID:AB_1575737
- Product name
- NDUFA13 purified MaxPab mouse polyclonal antibody (B02P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human NDUFA13 protein.
- Antigen sequence
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSM
LAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIA
LLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWK
VGESVFHTTRWVPPLIGELYGLRTTEEALHASHGF
MWYT- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differentially expressed proteins in malignant and benign adrenocortical tumors.
Kjellin H, Johansson H, Höög A, Lehtiö J, Jakobsson PJ, Kjellman M
PloS one 2014;9(2):e87951
PloS one 2014;9(2):e87951
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NDUFA13 MaxPab polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NDUFA13 expression in transfected 293T cell line (H00051079-T02) by NDUFA13 MaxPab polyclonal antibody.Lane 1: NDUFA13 transfected lysate(15.84 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to NDUFA13 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of purified MaxPab antibody to NDUFA13 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol