Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310556 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A16 antibody: synthetic peptide directed towards the N terminal of human SLC25A16
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQ
KEGFL GLYKGNGAMM- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The yeast mitochondrial carrier Leu5p and its human homologue Graves' disease protein are required for accumulation of coenzyme A in the matrix.
Prohl C, Pelzer W, Diekert K, Kmita H, Bedekovics T, Kispal G, Lill R
Molecular and cellular biology 2001 Feb;21(4):1089-97
Molecular and cellular biology 2001 Feb;21(4):1089-97
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting