Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 102-PA52 - Provider product page
- Provider
- ReliaTech GmbH
- Product name
- MesP1
- Antibody type
- Polyclonal
- Antigen
- Recombinant human MesP1
- Description
- antibody Protein-A purified from serum
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRS
LVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVG
RRGARSSRLGSGQRQSASEREKLRMRTLARALHEL
RRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVL
GLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQ
TRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGA
RAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPG
DVLALLETWMPLSPLEWLPEEPK- Antibody clone number
- Rabbit IG
- Vial size
- 200 µl
- Storage
- Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing.
- Handling
- Restore in sterile water to a concentration of 0.1-1.0 mg/ml. The antibody solution should be gently mixed before use.
No comments: Submit comment
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Western Analysis of anti-human MesP1. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions.
- Sample type
- Purified recombinant protein
Supportive validation
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining of cryo-sections of unfixed human foreskin with anti-human MesP1 (dilution 1:100) and counter staining of nuclei with Dapi. Note: The specific green MesP1 signal is visible in the epidermis and in dermal blood vessels (left and middle picture). Right picture: Negative control without primary antibody.
- Sample type
- Human Foreskin
- Submitted by
- ReliaTech GmbH (provider)
- Main image
- Experimental details
- Immunofluorescence staining of cryo-sections of unfixed human foreskin with anti-human MesP1 (dilution 1:100) and counter staining of nuclei with Dapi. Note: The specific green MesP1 signal is visible in the epidermis and in dermal blood vessels. The experiment was performed by the research group of Prof. Dr. J. Wilting and Dr. K. Buttler, University Medicine Göttingen, Germany.
- Sample type
- Human Foreskin