ABIN503199

antibody from antibodies-online

Targeting: ZNF710 DKFZp547K1113, FLJ00306, FLJ37393

Western blot (Data presented on provider website)

Antibody Data

Product number

ABIN503199

Provider

antibodies-online

Product name

anti-Zinc Finger Protein 710 (ZNF710) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-ZNF710 antibody: synthetic peptide directed towards the N terminal of human ZNF710

Reactivity

Human, Mouse, Rat, Canine

Host

Rabbit

Antigen sequence

KFEKVEEEEQEVYEVSVPGDDKDAGPAEAPAEAAS
GGCDA LVQSSAVKMI


Vial size

50 µg

References

Submitted references

High-throughput sequencing of complete human mtDNA genomes from the Philippines.

Gunnarsdóttir ED, Li M, Bauchet M, Finstermeier K, Stoneking M
Genome research 2011 Jan;21(1):1-11

---

The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).

Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J, MGC Project Team
Genome research 2004 Oct;14(10B):2121-7