Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405957 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SRR1 Domain Containing (SRRD) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SRRD antibody: synthetic peptide directed towards the middle region of human SRRD
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
DIFNDTSVHWFPVQKLEQLSIDIWEFREEPDYQDC
EDLEI IRNKREDPSA- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The DNA sequence of human chromosome 22.
Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP
Nature 1999 Dec 2;402(6761):489-95
Nature 1999 Dec 2;402(6761):489-95
No comments: Submit comment
No validations: Submit validation data