Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309815 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 100 (ZNF100) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF100 antibody: synthetic peptide directed towards the N terminal of human ZNF100
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MDDPRYGMCPLKGASGCPGAERSLLVQSYFEKGPL
TFRDV AIEFSLEEWQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Clustered organization of homologous KRAB zinc-finger genes with enhanced expression in human T lymphoid cells.
Bellefroid EJ, Marine JC, Ried T, Lecocq PJ, Rivière M, Amemiya C, Poncelet DA, Coulie PG, de Jong P, Szpirer C
The EMBO journal 1993 Apr;12(4):1363-74
The EMBO journal 1993 Apr;12(4):1363-74
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting