PAB20674

RESF1 antibody from Abnova Corporation
C12orf35, FLJ10652, FLJ20696, GET, KIAA1551, UTA2-1

Antibody data

Product number
PAB20674
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20674, RRID:AB_10964694
Product name
C12orf35 polyclonal antibody
Provider product page
Abnova Corporation - PAB20674
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant C12orf35.
Antigen sequence
LTKLESSPRKLHKDKRQENKHKTFLPVKGNTEKSN
MLEFKLCPDILLKNTNSVEERKDVKPHPRKEQAPL
QVSGIKSTKEDWLKFVATKKRTQKDSQERDNVNSR
LSKRSFSADGFEMLQNPVKDSKEMFQTY
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -