HPA013816

RESF1 antibody from MilliporeSigma / Merck KGaA
C12orf35, FLJ10652, FLJ20696, GET, KIAA1551, UTA2-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013816
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013816, RRID:AB_1848661
Product name
Anti-C12orf35 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013816
Antibody type
Polyclonal
Antigen
Uncharacterized protein C12orf35 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTKLESSPRKLHKDKRQENKHKTFLPVKGNTEKSN
MLEFKLCPDILLKNTNSVEERKDVKPHPRKEQAPL
QVSGIKSTKEDWLKFVATKKRTQKDSQERDNVNSR
LSKRSFSADGFEMLQNPVKDSKEMFQTY
Storage
-20C
Provider Type Product Number
- No reagents -