HPA015622

RESF1 antibody from Atlas Antibodies
C12orf35, FLJ10652, FLJ20696, GET, KIAA1551, UTA2-1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015622
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015622, RRID:AB_1848663
Product name
Anti-KIAA1551
Provider product page
Atlas Antibodies - HPA015622
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KEALSNKASKKICVKNVPCDSEHMRPSKLAVQVES
CGKSNEKHSSGVQTSKESLNGLTSHGKNLKIHHSQ
ESKTYNILRNVKEKVGGKQPDKIWIDKTKLDKLTN
ISNEAQFSQMPPQVKDQKKLYLNRVGFKCTERE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -