WH0005696M1

PSMB8 antibody from MilliporeSigma / Merck KGaA
beta5i, D6S216E, LMP7, PSMB5i, RING10
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0005696M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0005696M1, RRID:AB_1843168
Product name
Monoclonal Anti-PSMB8 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0005696M1
Antibody type
Monoclonal
Antigen
PSMB8 (AAH01114, a.a. 173-273) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVM
DSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVV
NMYHMKEDGWVKVESTDVSDLLHQYREANQ* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -