H00005696-M01

PSMB8 antibody from Abnova Corporation
beta5i, D6S216E, LMP7, PSMB5i, RING10

Antibody data

Product number
H00005696-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005696-M01, RRID:AB_464237
Product name
PSMB8 monoclonal antibody (M01), clone 1B3
Provider product page
Abnova Corporation - H00005696-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PSMB8.
Antigen sequence
DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVM
DSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVV
NMYHMKEDGWVKVESTDVSDLLHQYREANQ
Isotype
IgG
Antibody clone number
1B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -