Explore
Validate
LearnH00006046-M01
antibody from Abnova Corporation
Targeting: BRD2
BRD2-IT1, D6S113E, FSRG1, KIAA9001, NAT, RING3
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006046-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006046-M01, RRID:AB_605989
- Product name
- BRD2 monoclonal antibody (M01), clone 3D10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BRD2.
- Antigen sequence
QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAK
LAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTT
VLNIPHPSVISSPLLKSLHS- Isotype
- IgG
- Antibody clone number
- 3D10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma.
Lee YS, Lee JW, Jang JW, Chi XZ, Kim JH, Li YH, Kim MK, Kim DM, Choi BS, Kim EG, Chung JH, Lee OJ, Lee YM, Suh JW, Chuang LS, Ito Y, Bae SC
Cancer cell 2013 Nov 11;24(5):603-16
Cancer cell 2013 Nov 11;24(5):603-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BRD2 monoclonal antibody (M01), clone 3D10. Western Blot analysis of BRD2 expression in Hela S3 NE(Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BRD2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
