HPA015955

CTNND1 antibody from Atlas Antibodies
CTNND, KIAA0384, p120, p120cas, p120ctn

Antibody data

Product number
HPA015955
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015955, RRID:AB_1846068
Product name
Anti-CTNND1
Provider product page
Atlas Antibodies - HPA015955
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQ
DANPLMANGTLTRRHQNGRFVGDADLERQKFSDLK
LNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEG
AMSVVSVETSDDGTTR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.