H00000291-A01

SLC25A4 antibody from Abnova Corporation
ANT1, PEO2, PEO3, T1
No application information provided.

Antibody data

Product number
H00000291-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000291-A01, RRID:AB_463476
Product name
SLC25A4 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00000291-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length recombinant SLC25A4.
Antigen sequence
MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLL
LRVQHASRQISAEKQYKGIIDCVVRIPKEQGFLSF
WRGNLANVIRYFPTQALNFAFKDKYKQLFLGGVDR
HKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKGAAQREFHGLGDCIIKIFKSDGLRGLYQ
GFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHI
FVSWMIAQSVTAVAGLVSYPFDTVRRRMMMQSGRK
GADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLR
GMGGAFVLVLYDEIKKYV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -