HPA036664

antibody from Atlas Antibodies

Targeting: LRP2BP DKFZp761O0113

Antibody data

Submit

Validation data

Product number: HPA036664 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA036664, RRID:AB_10672361
Product name: Anti-LRP2BP
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GNLVEYYYKMKFFTKCVAFSKRIADYDEVHDIPMI AQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRD ETTAKHYYSKACRLNPALADELHSL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LRP2BP protein structure - HPA036664 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using HPA036664 antibody. Corresponding LRP2BP RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, fallopian tube, liver and testis using Anti-LRP2BP antibody HPA036664 (A) shows similar protein distribution across tissues to independent antibody HPA036665 (B).
Antibody #2 product nr: HPA036665
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows distinct positivity in neuronal processes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows weak cytoplasmic positivity in Purkinje cells as well as positivity in neural fibers.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Sample type: HUMAN