HPA040066

antibody from Atlas Antibodies

Targeting: SYNM DMN, KIAA0353, SYN

Antibody data

Submit

Validation data

Product number: HPA040066 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA040066, RRID:AB_2676830
Product name: Anti-SYNM
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FLGSGYSSSATTQQENSYGKAVSSQTNVRTFSPTY GLLRNTEAQVKTFPDRPKAGDTREVPVYIGEDSTI ARESYRDRRDKVAAGASESTRSNE
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SYNM protein structure - HPA040066 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human smooth muscle and liver tissues using Anti-SYNM antibody. Corresponding SYNM RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, prostate, smooth muscle and testis using Anti-SYNM antibody HPA040066 (A) shows similar protein distribution across tissues to independent antibody HPA044200 (B).
Antibody #2 product nr: HPA044200
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human smooth muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate using Anti-SYNM antibody HPA040066.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SYNM antibody HPA040066.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-SYNM antibody HPA040066.
Sample type: HUMAN