Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002483-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002483-M01, RRID:AB_464342
- Product name
- FRG1 monoclonal antibody (M01), clone 4A5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FRG1.
- Antigen sequence
MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREE
DEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYI
HALDNGLFTLGAPHKEVDEGPSPPEQFTAVKLSDS
RIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEP
VFQNGKMALLASNSCFIRCNEAGDIEAKSKTAGEE
EMIKIRSCAERETKKKDDIPEEDKGNVKQCEINYV
KKFQSFQDHKLKISKEDSKILKKARKDGFLHETLL
DRRAKLKADRYCK- Isotype
- IgG
- Antibody clone number
- 4A5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references RNA interference improves myopathic phenotypes in mice over-expressing FSHD region gene 1 (FRG1).
Wallace LM, Garwick-Coppens SE, Tupler R, Harper SQ
Molecular therapy : the journal of the American Society of Gene Therapy 2011 Nov;19(11):2048-54
Molecular therapy : the journal of the American Society of Gene Therapy 2011 Nov;19(11):2048-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- FRG1 monoclonal antibody (M01), clone 4A5 Western Blot analysis of FRG1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of FRG1 expression in transfected 293T cell line by FRG1 monoclonal antibody (M01), clone 4A5.Lane 1: FRG1 transfected lysate(29 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to FRG1 on HeLa cell. [antibody concentration 35 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of FRG1 transfected lysate using anti-FRG1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FRG1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol