Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404902 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cholecystokinin (CCK) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGW
MDFGR RSAEEYEYPS- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Generation of functional insulin-producing cells in the gut by Foxo1 ablation.
Readability of consumer medication information for intranasal corticosteroid inhalers.
Levels of serum leptin, cholecystokinin, plasma lipid and lipoprotein differ between patients with gallstone or/and those with hepatolithiasis.
Talchai C, Xuan S, Kitamura T, DePinho RA, Accili D
Nature genetics 2012 Mar 11;44(4):406-12, S1
Nature genetics 2012 Mar 11;44(4):406-12, S1
Readability of consumer medication information for intranasal corticosteroid inhalers.
Roskos SE, Wallace LS, Weiss BD
American journal of health-system pharmacy : AJHP : official journal of the American Society of Health-System Pharmacists 2008 Jan 1;65(1):65-8
American journal of health-system pharmacy : AJHP : official journal of the American Society of Health-System Pharmacists 2008 Jan 1;65(1):65-8
Levels of serum leptin, cholecystokinin, plasma lipid and lipoprotein differ between patients with gallstone or/and those with hepatolithiasis.
Lei ZM, Ye MX, Fu WG, Chen Y, Fang C, Li J
Hepatobiliary & pancreatic diseases international : HBPD INT 2008 Feb;7(1):65-9
Hepatobiliary & pancreatic diseases international : HBPD INT 2008 Feb;7(1):65-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting