Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00064324-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00064324-M08, RRID:AB_1112601
- Product name
- NSD1 monoclonal antibody (M08), clone 4F1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NSD1.
- Antigen sequence
DQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQ
SNFSEPLNGCTMQLSTVSGTSQNAYGQDSPSCYIP
LRRLQDLASMINVEYLNGSADGSESFQDPEKSDSR
AQT- Isotype
- IgG
- Antibody clone number
- 4F1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Regulation of NF-kappaB by NSD1/FBXL11-dependent reversible lysine methylation of p65.
Lu T, Jackson MW, Wang B, Yang M, Chance MR, Miyagi M, Gudkov AV, Stark GR
Proceedings of the National Academy of Sciences of the United States of America 2010 Jan 5;107(1):46-51
Proceedings of the National Academy of Sciences of the United States of America 2010 Jan 5;107(1):46-51
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NSD1 is 3 ng/ml as a capture antibody.