Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA037480 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA037480, RRID:AB_10696934
- Product name
- Anti-MICU1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGR
ITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEG
KGLTFQEVENFFTFL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter
Directed evolution of APEX2 for electron microscopy and proximity labeling
Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling
Lee Y, Min C, Kim T, Song H, Lim Y, Kim D, Shin K, Kang M, Kang J, Youn H, Lee J, An J, Park K, Lim J, Kim J, Kim J, Park Z, Kim Y, Wang J, Kim D, Eom S
EMBO reports 2015 October;16(10):1318-1333
EMBO reports 2015 October;16(10):1318-1333
Directed evolution of APEX2 for electron microscopy and proximity labeling
Lam S, Martell J, Kamer K, Deerinck T, Ellisman M, Mootha V, Ting A
Nature Methods 2014 November;12(1):51-54
Nature Methods 2014 November;12(1):51-54
Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling
Logan C, Szabadkai G, Sharpe J, Parry D, Torelli S, Childs A, Kriek M, Phadke R, Johnson C, Roberts N, Bonthron D, Pysden K, Whyte T, Munteanu I, Foley A, Wheway G, Szymanska K, Natarajan S, Abdelhamed Z, Morgan J, Roper H, Santen G, Niks E, van der Pol W, Lindhout D, Raffaello A, De Stefani D, den Dunnen J, Sun Y, Ginjaar I, Sewry C, Hurles M, Rizzuto R, Duchen M, Muntoni F, Sheridan E
Nature Genetics 2013 December;46(2):188-193
Nature Genetics 2013 December;46(2):188-193
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in cortical cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong granular positivity in cytoplasm in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows moderate granular positivity in cytoplasm in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong granular positivity in cytoplasm in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong granular positivity in cytoplasm in glandular cells.
- Sample type
- HUMAN
