HPA037480

MICU1 antibody from Atlas Antibodies
CALC, CBARA1, EFHA3, FLJ12684
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA037480
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA037480, RRID:AB_10696934
Product name
Anti-MICU1
Provider product page
Atlas Antibodies - HPA037480
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGR
ITERQFGGMLLAYSGVQSKKLTAMQRQLKKHFKEG
KGLTFQEVENFFTFL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -