HPA040006
antibody from Atlas Antibodies
Targeting: TRMT112
HSPC152, HSPC170, hTrm112, TRM112, TRMT11-2
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040006 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA040006, RRID:AB_10793859
- Product name
- Anti-TRMT112
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGT
LQCPESGRMFPISRGIPNMLLSEEETES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Stability of Ribosome Biogenesis Factor WBSCR22 Is Regulated by Interaction with TRMT112 via Ubiquitin-Proteasome Pathway.
Õunap K, Leetsi L, Matsoo M, Kurg R
PloS one 2015;10(7):e0133841
PloS one 2015;10(7):e0133841
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Western blot analysis using Anti-TRMT112 antibody HPA040006 (A) shows similar pattern to independent antibody HPA039901 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows nuclear and cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN