Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011972 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA011972, RRID:AB_1855134
- Product name
- Anti-PDGFB
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELD
LNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAE
CKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCS
GCCNNRNVQCRPTQVQLRPVQVRKIEIV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references aPKCλ/ι and aPKCζ contribute to podocyte differentiation and glomerular maturation.
Hartleben B, Widmeier E, Suhm M, Worthmann K, Schell C, Helmstädter M, Wiech T, Walz G, Leitges M, Schiffer M, Huber TB
Journal of the American Society of Nephrology : JASN 2013 Feb;24(2):253-67
Journal of the American Society of Nephrology : JASN 2013 Feb;24(2):253-67
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lateral ventricle shows strong cytoplasmic positivity in granular pattern in neuronal cells.