ABIN405168

antibody from antibodies-online

Targeting: TAL2 bHLHa19

Western blot (Supportive data in Antibodypedia)

Antibody Data

Product number

ABIN405168

Provider

antibodies-online

Product name

anti-T-Cell Acute Lymphocytic Leukemia 2 (TAL2) (N-Term) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the N terminal of human TAL2

Description

Affinity Purified

Reactivity

Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish

Host

Rabbit

Antigen sequence

TRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDK
KLSKN ETLRLAMRYI


Epitope

N-Term

Vial size

50 μg

Concentration

1mg/mL

Storage

-20°C

Handling

Avoid repeated freeze-thaw cycles.

References

Submitted references

The T-cell oncogene Tal2 Is a Target of PU.1 and upregulated during osteoclastogenesis.

Courtial N, Mücke C, Herkt S, Kolodziej S, Hussong H, Lausen J
PloS one 2013;8(9):e76637

---

DNA sequence and analysis of human chromosome 9.

Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blöcker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I
Nature 2004 May 27;429(6990):369-74

Western blot

Supportive validation

Submitted by

antibodies-online (provider)

Main image

Experimental details

Image(s): Western Blotting