Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011240-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011240-M01, RRID:AB_566053
- Product name
- PADI2 monoclonal antibody (M01), clone 4D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PADI2.
- Antigen sequence
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPA
GAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL
LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIP
IDQ- Isotype
- IgG
- Antibody clone number
- 4D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Inflammatory but not apoptotic death of granulocytes citrullinates fibrinogen.
Blachère NE, Parveen S, Fak J, Frank MO, Orange DE
Arthritis research & therapy 2015 Dec 17;17:369
Arthritis research & therapy 2015 Dec 17;17:369
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PADI2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol