Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [11]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026330-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026330-M01, RRID:AB_425934
- Product name
- GAPDS monoclonal antibody (M01), clone 2E3-2E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GAPDS.
- Antigen sequence
MSKRDIVLTNVTVVQLLRQPCPVTRAPPPPEPKAE
VEPQPQPEPTPVREEIKPPPPPLPPHPATPPPKMV
SVARELTVGINGFGRIGRLVLRACMEKGVKVVAVN
DPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVV
DNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLS
IQAASDHISAGAQRVVISAPSPDAPMFVMGVNEND
YNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEG
LMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIP
ASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVV
DLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTE
DEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISW
YDNEYGYSHRVVDLLRYMFSRDK- Isotype
- IgG
- Antibody clone number
- 2E3-2E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Down-regulation of miR-96 by bone morphogenetic protein signaling is critical for vascular smooth muscle cell phenotype modulation.
Inhibition of microRNA-302 (miR-302) by bone morphogenetic protein 4 (BMP4) facilitates the BMP signaling pathway.
Isolation of antibodies against different protein conformations using immunoaffinity chromatography.
Bone morphogenetic protein 4 promotes vascular smooth muscle contractility by activating microRNA-21 (miR-21), which down-regulates expression of family of dedicator of cytokinesis (DOCK) proteins.
The amiloride derivative phenamil attenuates pulmonary vascular remodeling by activating NFAT and the bone morphogenetic protein signaling pathway.
down-regulation of Kruppel-like factor-4 (KLF4) by microRNA-143/145 is critical for modulation of vascular smooth muscle cell phenotype by transforming growth factor-beta and bone morphogenetic protein 4.
Molecular basis for antagonism between PDGF and the TGFbeta family of signalling pathways by control of miR-24 expression.
Smad proteins bind a conserved RNA sequence to promote microRNA maturation by Drosha.
Induction of microRNA-221 by platelet-derived growth factor signaling is critical for modulation of vascular smooth muscle phenotype.
SMAD proteins control DROSHA-mediated microRNA maturation.
Investigation of glyceraldehyde-3-phosphate dehydrogenase from human sperms.
Kim S, Hata A, Kang H
Journal of cellular biochemistry 2014 May;115(5):889-95
Journal of cellular biochemistry 2014 May;115(5):889-95
Inhibition of microRNA-302 (miR-302) by bone morphogenetic protein 4 (BMP4) facilitates the BMP signaling pathway.
Kang H, Louie J, Weisman A, Sheu-Gruttadauria J, Davis-Dusenbery BN, Lagna G, Hata A
The Journal of biological chemistry 2012 Nov 9;287(46):38656-64
The Journal of biological chemistry 2012 Nov 9;287(46):38656-64
Isolation of antibodies against different protein conformations using immunoaffinity chromatography.
Kuravsky ML, Schmalhausen EV, Pozdnyakova NV, Muronetz VI
Analytical biochemistry 2012 Jul 1;426(1):47-53
Analytical biochemistry 2012 Jul 1;426(1):47-53
Bone morphogenetic protein 4 promotes vascular smooth muscle contractility by activating microRNA-21 (miR-21), which down-regulates expression of family of dedicator of cytokinesis (DOCK) proteins.
Kang H, Davis-Dusenbery BN, Nguyen PH, Lal A, Lieberman J, Van Aelst L, Lagna G, Hata A
The Journal of biological chemistry 2012 Feb 3;287(6):3976-86
The Journal of biological chemistry 2012 Feb 3;287(6):3976-86
The amiloride derivative phenamil attenuates pulmonary vascular remodeling by activating NFAT and the bone morphogenetic protein signaling pathway.
Chan MC, Weisman AS, Kang H, Nguyen PH, Hickman T, Mecker SV, Hill NS, Lagna G, Hata A
Molecular and cellular biology 2011 Feb;31(3):517-30
Molecular and cellular biology 2011 Feb;31(3):517-30
down-regulation of Kruppel-like factor-4 (KLF4) by microRNA-143/145 is critical for modulation of vascular smooth muscle cell phenotype by transforming growth factor-beta and bone morphogenetic protein 4.
Davis-Dusenbery BN, Chan MC, Reno KE, Weisman AS, Layne MD, Lagna G, Hata A
The Journal of biological chemistry 2011 Aug 12;286(32):28097-110
The Journal of biological chemistry 2011 Aug 12;286(32):28097-110
Molecular basis for antagonism between PDGF and the TGFbeta family of signalling pathways by control of miR-24 expression.
Chan MC, Hilyard AC, Wu C, Davis BN, Hill NS, Lal A, Lieberman J, Lagna G, Hata A
The EMBO journal 2010 Feb 3;29(3):559-73
The EMBO journal 2010 Feb 3;29(3):559-73
Smad proteins bind a conserved RNA sequence to promote microRNA maturation by Drosha.
Davis BN, Hilyard AC, Nguyen PH, Lagna G, Hata A
Molecular cell 2010 Aug 13;39(3):373-84
Molecular cell 2010 Aug 13;39(3):373-84
Induction of microRNA-221 by platelet-derived growth factor signaling is critical for modulation of vascular smooth muscle phenotype.
Davis BN, Hilyard AC, Nguyen PH, Lagna G, Hata A
The Journal of biological chemistry 2009 Feb 6;284(6):3728-38
The Journal of biological chemistry 2009 Feb 6;284(6):3728-38
SMAD proteins control DROSHA-mediated microRNA maturation.
Davis BN, Hilyard AC, Lagna G, Hata A
Nature 2008 Jul 3;454(7200):56-61
Nature 2008 Jul 3;454(7200):56-61
Investigation of glyceraldehyde-3-phosphate dehydrogenase from human sperms.
Shchutskaya YY, Elkina YL, Kuravsky ML, Bragina EE, Schmalhausen EV
Biochemistry. Biokhimiia 2008 Feb;73(2):185-91
Biochemistry. Biokhimiia 2008 Feb;73(2):185-91
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of GAPDHS expression in transfected 293T cell line by GAPDS monoclonal antibody (M01), clone 2E3-2E10.Lane 1: GAPDHS transfected lysate(44.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GAPDHS is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to GAPDHS on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
