Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010602-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010602-A01, RRID:AB_529747
- Product name
- CDC42EP3 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CDC42EP3.
- Antigen sequence
IHIGKEGQHDVFGDISFLQGNYELLPGNQEKAHLG
QFPGHNEFFRANSTSDSVFTETPSPVLKNAIS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with Cdc42 effector proteins.
Schnack C, Danzer KM, Hengerer B, Gillardon F
Neuroscience 2008 Jul 17;154(4):1450-7
Neuroscience 2008 Jul 17;154(4):1450-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CDC42EP3 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of CDC42EP3 expression in K-562 ( Cat # L009V1 ).