HPA038437

antibody from Atlas Antibodies

Targeting: MYOZ1 CS-2, FATZ, MYOZ

Antibody data

Submit

Validation data

Product number: HPA038437 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038437, RRID:AB_2676009
Product name: Anti-MYOZ1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: AELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDL GPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPV DYNVDIG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYOZ1 protein structure - HPA038437 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and prostate tissues using Anti-MYOZ1 antibody. Corresponding MYOZ1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, skeletal muscle and testis using Anti-MYOZ1 antibody HPA038437 (A) shows similar protein distribution across tissues to independent antibody HPA037848 (B).
Antibody #2 product nr: HPA037848
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MYOZ1 antibody HPA038437.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-MYOZ1 antibody HPA038437.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MYOZ1 antibody HPA038437.
Sample type: HUMAN