Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA026863 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA026863, RRID:AB_10600900
- Product name
- Anti-CYP1B1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SSFVPVTIPHATTANTSVLGYHIPKDTVVFVNQWS
VNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVM
IFSVGKRRCIGEELSKMQLFLFISILAHQCDFRAN
PNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDS
AVQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A human brain vascular atlas reveals diverse mediators of Alzheimer's risk.
Human Skin-Derived Stem Cells as a Novel Cell Source for In Vitro Hepatotoxicity Screening of Pharmaceuticals
Yang AC, Vest RT, Kern F, Lee DP, Agam M, Maat CA, Losada PM, Chen MB, Schaum N, Khoury N, Toland A, Calcuttawala K, Shin H, Pálovics R, Shin A, Wang EY, Luo J, Gate D, Schulz-Schaeffer WJ, Chu P, Siegenthaler JA, McNerney MW, Keller A, Wyss-Coray T
Nature 2022 Mar;603(7903):885-892
Nature 2022 Mar;603(7903):885-892
Human Skin-Derived Stem Cells as a Novel Cell Source for In Vitro Hepatotoxicity Screening of Pharmaceuticals
Rodrigues R, De Kock J, Branson S, Vinken M, Meganathan K, Chaudhari U, Sachinidis A, Govaere O, Roskams T, De Boe V, Vanhaecke T, Rogiers V
Stem Cells and Development 2014;23(1):44-55
Stem Cells and Development 2014;23(1):44-55
No comments: Submit comment
No validations: Submit validation data