Explore
Validate
LearnPAB20657
antibody from Abnova Corporation
Targeting: LPAR3
Edg-7, EDG7, HOFNH30, LP-A3, LPA3, RP4-678I3
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB20657 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB20657, RRID:AB_10965615
- Product name
- LPAR3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant LPAR3.
- Antigen sequence
MNECHYDKHMDFFYNRSNTDTVDDWTGTK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LPAR3 polyclonal antibody (Cat # PAB20657).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG with LPAR3 polyclonal antibody (Cat # PAB20657) at 1-4 ug/mL dilution shows positivity in plasma membrane.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder with LPAR3 polyclonal antibody (Cat # PAB20657) shows strong cytoplasmic positivity in urothelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
