A1059-62J

antibody from United States Biological

Targeting: AGRP Agrt, ART, ASIP2

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: A1059-62J - Provider product page
Provider: United States Biological
Product name: AgRP (Agouti Related Protein, ART, AGRT, ASIP2, Agouti-related transcript)
Antibody type: Polyclonal
Antigen: Synthetic peptide corresponding to aa 82-131, SPRRCVRLHESCLG QQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT a region within the carboxy domain of mouse agouti related protein.
Description: Serum
Host: Guinea Pig
Isotype: IgG
Vial size: Blue Ice
Concentration: ~1mg/ml
Storage: 4°C (-20°C Glycerol)

AGRP protein structure - A1059-62J shown in red.