Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB14305 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB14305, RRID:AB_10549574
- Product name
- Agrp polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Guinea pig polyclonal antibody raised against synthetic peptide of Agrp.
- Antigen sequence
SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFC
YCRKLGTATNLCSRT- Storage
- Store at 4°C on dry atmosphere.After reconstitution with deionized water, store at -20°C or lower.Aliquot to avoid repeated freezing and thawing.
Submitted references Prenatal development of hypothalamic neuropeptide systems in the nonhuman primate.
Grayson BE, Allen SE, Billes SK, Williams SM, Smith MS, Grove KL
Neuroscience 2006 Dec 28;143(4):975-86
Neuroscience 2006 Dec 28;143(4):975-86
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical detection of Agrp in the arcuate nucleus of rat brain using Agrp polyclonal antibody (Cat # PAB14305) incubated at the dilution of 1 : 1000 ~ 2000 in PBS overnight followed by incubation with Alexa-568 goat anti-guinea pig (1 : 500) secondary antibody.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- The cryostat section of the sheep hypothalamus was incubated in Agrp polyclonal antibody (Cat # PAB14305) at the dilution of 1 : 1000 overnight followed by incubation with biotinylated secondary antibodies. Cell bodies and nerve terminals in the sheep brain are intensely stained. This figure shows staining of cells when no pre-absorption is performed.
- Validation comment
- Immunohistochemistry (Frozen sections)