HPA043466

antibody from Atlas Antibodies

Targeting: LZTFL1 BBS17

Antibody data

Submit

Validation data

Product number: HPA043466 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043466, RRID:AB_2678491
Product name: Anti-LZTFL1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRE LLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEG GTAELLN
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

LZTFL1 protein structure - HPA043466 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-LZTFL1 antibody. Corresponding LZTFL1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human liver, lymph node, skeletal muscle and testis using Anti-LZTFL1 antibody HPA043466 (A) shows similar protein distribution across tissues to independent antibody HPA048447 (B).
Antibody #2 product nr: HPA048447
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-LZTFL1 antibody HPA043466.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-LZTFL1 antibody HPA043466.
Sample type: HUMAN