Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036688 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA036688, RRID:AB_10671968
- Product name
- Anti-EML4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTES
VIQSNTPTPPPSQPLNETAEEESRISSSPTLLENS
LEQTVEPSEDHSEEES- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Neural differentiation modulates the vertebrate brain specific splicing program.
Madgwick A, Fort P, Hanson PS, Thibault P, Gaudreau MC, Lutfalla G, Möröy T, Abou Elela S, Chaudhry B, Elliott DJ, Morris CM, Venables JP
PloS one 2015;10(5):e0125998
PloS one 2015;10(5):e0125998
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol, intermediate filaments & microtubules.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, gallbladder, kidney and lymph node using Anti-EML4 antibody HPA036688 (A) shows similar protein distribution across tissues to independent antibody HPA036687 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node using Anti-EML4 antibody HPA036688.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-EML4 antibody HPA036688.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-EML4 antibody HPA036688.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder using Anti-EML4 antibody HPA036688.
- Sample type
- HUMAN