ABIN405547
antibody from antibodies-online
Targeting: MUL1
C1orf166, FLJ12875, GIDE, MAPL, MULAN, RNF218
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405547 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mitochondrial E3 Ubiquitin Protein Ligase 1 (MUL1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C1orf166 antibody: synthetic peptide directed towards the middle region of human C1orf166
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFA
TCATL FFILRKQYLQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Modulation of stretch-induced myocyte remodeling and gene expression by nitric oxide: a novel role for lipoma preferred partner in myofibrillogenesis.
0610009K11Rik, a testis-specific and germ cell nuclear receptor-interacting protein.
Hooper CL, Paudyal A, Dash PR, Boateng SY
American journal of physiology. Heart and circulatory physiology 2013 May 15;304(10):H1302-13
American journal of physiology. Heart and circulatory physiology 2013 May 15;304(10):H1302-13
0610009K11Rik, a testis-specific and germ cell nuclear receptor-interacting protein.
Zhang H, Denhard LA, Zhou H, Liu LH, Lan ZJ
Biochemical and biophysical research communications 2008 Feb 22;366(4):898-904
Biochemical and biophysical research communications 2008 Feb 22;366(4):898-904
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting