HPA062512

ZNF781 antibody from Atlas Antibodies
FLJ37549
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA062512
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062512, RRID:AB_2684788
Product name
Anti-ZNF781
Provider product page
Atlas Antibodies - HPA062512
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQ
IC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -