H00163115-M

ZNF781 antibody from Abnova Corporation
FLJ37549
No application information provided.

Antibody data

Product number
H00163115-M
Provider
Abnova Corporation
Product name
ZNF781 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00163115-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ZNF781.
Antigen sequence
MQRNAMYLKNVAETACNFQLTQYQISHANQKPYEC
QICGKPFRKRAHLTQHNRIHTGGKPYECKECGKVF
ICCSTLIQHKRTHTSEKPYECLECRKTFRRSAHLI
RHQRIHTGEKPYKCKQCWKAFASVSDLIDIGKFTL
MRDFTNVQNVGRHLTIAQLLFSIREFTLVRSPLNV
RNVAKHSIIAQHLLNTRELILMRNLMNVRNVKRLL
GKVHILLNIKEFILVRNHMSVSNVGRLSLVFLILI
DIREFTLVKNPMNVKNVVELLTIVQLLFNTREFTL
VRRLMNISSVGRFLSPVQHLFNIREHILMKNLMNV
SNARRPSSIMHI
Provider Type Product Number
- No reagents -