Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017353 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017353, RRID:AB_1852135
- Product name
- Anti-KCNJ5
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ
RYMEKSGKCNVHHGNVQETY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references DACH1, a Zona Glomerulosa Selective Gene in the Human Adrenal, Activates Transforming Growth Factor- Signaling and Suppresses Aldosterone Secretion
Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension
Zhou J, Shaikh L, Neogi S, McFarlane I, Zhao W, Figg N, Brighton C, Maniero C, Teo A, Azizan E, Brown M
Hypertension 2015 April;65(5):1103-1110
Hypertension 2015 April;65(5):1103-1110
Somatic mutations in ATP1A1 and CACNA1D underlie a common subtype of adrenal hypertension
Azizan E, Poulsen H, Tuluc P, Zhou J, Clausen M, Lieb A, Maniero C, Garg S, Bochukova E, Zhao W, Shaikh L, Brighton C, Teo A, Davenport A, Dekkers T, Tops B, Küsters B, Ceral J, Yeo G, Neogi S, McFarlane I, Rosenfeld N, Marass F, Hadfield J, Margas W, Chaggar K, Solar M, Deinum J, Dolphin A, Farooqi I, Striessnig J, Nissen P, Brown M
Nature Genetics 2013 August;45(9):1055-1060
Nature Genetics 2013 August;45(9):1055-1060
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and kCNJ5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424464).
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human adrenal gland and skeletal muscle tissues using HPA017353 antibody. Corresponding KCNJ5 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong cytoplasmic and membranous positivity in exocrine glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows no positivity in squamous epithelial cells as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human adrenal gland shows moderate to strong membranous positivity in glandular cells.
- Sample type
- HUMAN