Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038149 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA038149, RRID:AB_10672471
- Product name
- Anti-MAP4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EAPLAKDGVLTLANNVTPAKDVPPLSETEATPVPI
KDMEIAQTQKGISEDSHLESLQDVGQSAAPTFMIS
PETVTGT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells
Stadler C, Rexhepaj E, Singan V, Murphy R, Pepperkok R, Uhlén M, Simpson J, Lundberg E
Nature Methods 2013 February;10(4):315-323
Nature Methods 2013 February;10(4):315-323
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & microtubules.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, skeletal muscle, soft tissues and testis using Anti-MAP4 antibody HPA038149 (A) shows similar protein distribution across tissues to independent antibody HPA038150 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human heart muscle shows cytoplasmic positivity in myocytes.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-MAP4 antibody HPA038149.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human soft tissues using Anti-MAP4 antibody HPA038149.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skeletal muscle using Anti-MAP4 antibody HPA038149.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-MAP4 antibody HPA038149.
- Sample type
- HUMAN