Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011081-A01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011081-A01, RRID:AB_535242
- Product name
- KERA polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant KERA.
- Antigen sequence
GLPSRGFDVSSILDLQLSHNQLTKVPRISAHLQHL
HLDHNKIKSVNVSVICPSPSMLPAERDSFSYGPHL
RYLRLDGNEIKPPIPMALMTCFRLLQAVI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Resistance of corneal RFUVA–cross-linked collagens and small leucine-rich proteoglycans to degradation by matrix metalloproteinases.
Effects of ultraviolet-A and riboflavin on the interaction of collagen and proteoglycans during corneal cross-linking.
Zhang Y, Mao X, Schwend T, Littlechild S, Conrad GW
Investigative ophthalmology & visual science 2013 Feb 5;54(2):1014-25
Investigative ophthalmology & visual science 2013 Feb 5;54(2):1014-25
Effects of ultraviolet-A and riboflavin on the interaction of collagen and proteoglycans during corneal cross-linking.
Zhang Y, Conrad AH, Conrad GW
The Journal of biological chemistry 2011 Apr 15;286(15):13011-22
The Journal of biological chemistry 2011 Apr 15;286(15):13011-22
No comments: Submit comment
No validations: Submit validation data