Antibody data

Product number
H00005791-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005791-M04, RRID:AB_714827
Product name
PTPRE monoclonal antibody (M04), clone 2D10
Provider product page
Abnova Corporation - H00005791-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PTPRE.
Antigen sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGS
VTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQ
EEQVRVVRQFHFHGWPEIGI
Isotype
IgG
Antibody clone number
2D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -