Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008815-M07 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008815-M07, RRID:AB_490021
- Product name
- BANF1 monoclonal antibody (M07), clone M2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BANF1.
- Antigen sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLE
ERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGAN
AKQSRDCFGCLREWCDAFL- Isotype
- IgG
- Antibody clone number
- M2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Functional disruption of the moloney murine leukemia virus preintegration complex by vaccinia-related kinases.
Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y
The Journal of biological chemistry 2010 Jul 30;285(31):24032-43
The Journal of biological chemistry 2010 Jul 30;285(31):24032-43
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in PC-12.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BANF1 is approximately 10ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol