Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010992-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010992-M01, RRID:AB_566176
- Product name
- SF3B2 monoclonal antibody (M01), clone 5D2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SF3B2.
- Antigen sequence
YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAH
KVPPPWLIAMQRYGPPPSY- Isotype
- IgG
- Antibody clone number
- 5D2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SF3B2 monoclonal antibody (M01), clone 5D2. Western Blot analysis of SF3B2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SF3B2 on HeLa cell. [antibody concentration 60 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SF3B2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 6 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol