WH0002894M1

GRID1 antibody from Sigma-Aldrich
GluD1, KIAA1220
ELISA
Recommended by provider

Antibody data

Product number
WH0002894M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0002894M1, RRID:AB_1841782
Product name
Monoclonal Anti-GRID1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0002894M1
Antibody type
Monoclonal
Antigen
GRID1 (NP_060021, a.a. 349-442) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEF
REDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
KGLNGSLQERPMGSRLQGLTLKV* (without G
ST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -