Antibody data

Product number
H00002894-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002894-M01, RRID:AB_489813
Product name
GRID1 monoclonal antibody (M01), clone 1A9
Provider product page
Abnova Corporation - H00002894-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant GRID1.
Antigen sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEF
REDSSNPYVQFEILGTTYSETFGKDMRKLATWDSE
KGLNGSLQERPMGSRLQGLTLKV
Isotype
IgG
Antibody clone number
1A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -