HPA030162

FRS3 antibody from Atlas Antibodies
FRS2B, FRS2beta, SNT-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA030162
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA030162, RRID:AB_10599976
Product name
Anti-FRS3
Provider product page
Atlas Antibodies - HPA030162
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EEPVIITRNSHPAELDLPRAPQPPNALGYTVSSFS
NGCPGEGPRFSAPRRLSTSSLRHPSLGEESTHALI
APDEQSHTYVNTPASEDDHR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -