HPA038547

antibody from Atlas Antibodies

Targeting: HAL HIS

Antibody data

Submit

Validation data

Product number: HPA038547 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038547, RRID:AB_10669541
Product name: Anti-HAL
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKY IELDGDRLTTEDLVNLGKGRYKIKLTPTAEKRVQK SREVIDSIIKEKTVVYGITTGFGKFARTV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HAL protein structure - HPA038547 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, liver, skin and testis using Anti-HAL antibody HPA038547 (A) shows similar protein distribution across tissues to independent antibody HPA038548 (B).
Antibody #2 product nr: HPA038548
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate cytoplasmic positivity.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Sample type: HUMAN